PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108164.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Dof
Protein Properties Length: 348aa    MW: 37605 Da    PI: 8.3032
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108164.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-392181262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  XP_010108164.1 21 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 81
                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.6E-342379IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-272479IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5252579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MASSSAGRIM EKPGQEQLQQ QQQALKCPRC DSSNTKFCYY NNYSLSQPRH FCKACKRYWT  60
RGGTLRNVPV GGGCRKNKRV KRPNNSSSSS SLPDHHHHSH NHNSSSSASS SPSSLLSSNP  120
ASSVQPQIDL SSNHHNHISP LFYGLANNAP NSDILSLQFS RFMSSTTSGY DLVQPQLNNV  180
LGLGFSSGIN NTTDYNGQNG FNSNSTSLLP SYSSIFSTPS SSPSPTIASL FASKFTNGGR  240
GSNHFPSLSS PFEEVRITGN NGESEMGLMK QVKLENGQRR FDWNGIADDN SCAAQNHDDD  300
HHQTVEQSLG LSSSSDPSLN YWSINPTAVG GANWHDPGSL GSSVPSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108164.10.0Dof zinc finger protein
TrEMBLW9S6X20.0W9S6X2_9R
STRINGPOPTR_0011s05450.11e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-36Dof family protein